PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_476_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 723aa    MW: 80014 Da    PI: 8.7756
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_476_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.8e-093353721954
                                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                         Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  cra_locus_476_iso_1_len_3379_ver_3 335 FEHflHPYPKDSDKLMLAKQTGLTRSQVSNWFINARVR 372
                                         554459******************************88 PP

2BELL118.82.5e-38192263172
                                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                         erqe+q+kkakL+++l+eV++rY+qy++q+++vis Fe++ag+gsak Yt+lAl++iS++FrcLkdai +qi
  cra_locus_476_iso_1_len_3379_ver_3 192 ERQEIQMKKAKLVNMLDEVEQRYRQYHHQMHIVISWFEQAAGIGSAKTYTALALQTISKQFRCLKDAILGQI 263
                                         79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.5E-61108261IPR006563POX domain
PfamPF075261.3E-48113259IPR006563POX domain
PROSITE profilePS5007112.147313376IPR001356Homeobox domain
CDDcd000861.86E-11316376No hitNo description
SMARTSM003892.3E-9316380IPR001356Homeobox domain
SuperFamilySSF466897.7E-17317383IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28319383IPR009057Homeodomain-like
PfamPF059206.6E-18333372IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
XSHHHHHHHH DQQDISGLHA FLPRVHYNLY SPSIDLGAAR EVSRVQQGLS LSLSSQQPPA  60
YVSFRAEREV PSQPVMTTTI SPTSCGEEMR LSGGSSSSAS GISNGVNNGM QSVLLSSKYL  120
KAAQELLDEV VNVGKGVKNG GNHENGKVSK EIGESSDMGA ANNNSSGELL GQQIGGKESS  180
NSKRGSELTT AERQEIQMKK AKLVNMLDEV EQRYRQYHHQ MHIVISWFEQ AAGIGSAKTY  240
TALALQTISK QFRCLKDAIL GQIRAASKSL GEEDGSLFGK VEGGSSSSAS RLKFVDNQLR  300
QQRALQQLGM IQHNAWRPQR GLPERSVSVL RAWLFEHFLH PYPKDSDKLM LAKQTGLTRS  360
QVSNWFINAR VRLWKPMVEE MYMEEMKENE KNGLAEEKTS KSEQNEDSAS RSTAPLDKTS  420
TLENQNNNIT TPISMSPPTT ASPTGIQQQI QNHSGGFNLI GSPELDNITQ GSPKKPRSTD  480
NNMLHSPTSV PSINNMDAKT NDSNNEQLTI NFGSERQSRE GFSLLGAPTN FIGGFGTYPI  540
GELGRFSAEQ FPASYAGNGV SLTLGLPHCE NLSISGTHQT FLPNQNMQLG RGVEIGDTNE  600
YGSINTPTST HSTSVYENLN IQNRKRFAAQ LLPDFEHFFR KDMPAFAWPP WNGNTTLQMP  660
PSDQDTAHAH LPAILSKCLL DHRRAKLELV KQKLTPKIAK TRHQFLFXHL AHHQRWQHPS  720
KVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16322380563Homeobox protein Meis2
3k2a_B6e-16322380563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094236.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-162BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A068UQ860.0A0A068UQ86_COFCA; Uncharacterized protein
STRINGPOPTR_0016s07040.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467